PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s1267.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 357aa    MW: 39323.2 Da    PI: 8.8259
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s1267.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.72.8e-15501251796
                          E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                           +p +f++e++++  ++ +++l++e+g sW+v++   +++g   l +GW+ Fv +ng++ gD++ Fkl++  + e++v+v
  Kaladp0011s1267.1.p  50 NIPMQFIRENSLSYLTDEKMVLRTETGSSWSVNIV-ANTGGDN-LCGGWSAFVIDNGINKGDICEFKLMS--RLEMWVQV 125
                          59********888888999***************4.4444444.667********************986..67778887 PP

2B357.72.1e-18180271196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f++++ + +v   ++l +p +f++e++++  ++ +++l++e+g sW+v++    + g+y l +GW+ Fv +ng+k gD++ Fkl++  + 
  Kaladp0011s1267.1.p 180 FLTKMQRYNVEYGRILNIPMHFVRENSLSYCTDEKMVLRTETGSSWSVNI--VANTGGYKLCGGWSAFVIDNGIKKGDVCEFKLMS--RL 265
                          5566655666666788**********888888889***************..99999**************************986..67 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v+v
  Kaladp0011s1267.1.p 266 EMWVQV 271
                          778887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-6141IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.573141IPR003340B3 DNA binding domain
SuperFamilySSF1019366.47E-6141IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.9E-643129IPR003340B3 DNA binding domain
SuperFamilySSF1019361.12E-1449126IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.3E-1549125IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.60351129IPR003340B3 DNA binding domain
PfamPF023621.4E-1351125IPR003340B3 DNA binding domain
CDDcd100171.05E-1151125No hitNo description
Gene3DG3DSA:2.40.330.101.3E-20173271IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-20174272IPR015300DNA-binding pseudobarrel domain
CDDcd100173.22E-18178271No hitNo description
PfamPF023621.6E-16180271IPR003340B3 DNA binding domain
PROSITE profilePS5086313.31180275IPR003340B3 DNA binding domain
SMARTSM010193.5E-13180275IPR003340B3 DNA binding domain
SuperFamilySSF1019361.9E-9290352IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-9291352IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.613319356IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MVLRTETGSS WSVNIVANTG GDKLCRGWSA FVIDNGINKG DNTHAPIMQN IPMQFIRENS  60
LSYLTDEKMV LRTETGSSWS VNIVANTGGD NLCGGWSAFV IDNGINKGDI CEFKLMSRLE  120
MWVQVTPNPK AASRTSSDGP LSCPPRNAEV KLRTVKPELE HVIQNALKAA DASSIGPPSF  180
LTKMQRYNVE YGRILNIPMH FVRENSLSYC TDEKMVLRTE TGSSWSVNIV ANTGGYKLCG  240
GWSAFVIDNG IKKGDVCEFK LMSRLEMWVQ VTPNPKVASR TSRNGPLSCP PRNAEVKLRT  300
VKPELEHVNI VANMGGYKLC GGWSAFVSDN GIKKGYVCEF KLMSRLEMRV EVTPKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-19B3 family protein